Lineage for d1b9e.2 (1b9e D:,C:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 746752Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 746753Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 746754Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 746759Protein Insulin [56996] (3 species)
  7. 746769Species Human (Homo sapiens) [TaxId:9606] [56998] (60 PDB entries)
  8. 746843Domain d1b9e.2: 1b9e D:,C: [43886]

Details for d1b9e.2

PDB Entry: 1b9e (more details), 2.5 Å

PDB Description: human insulin mutant serb9glu
PDB Compounds: (C:) protein (insulin), (D:) protein (insulin)

SCOP Domain Sequences for d1b9e.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1b9e.2 g.1.1.1 (D:,C:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqhlcgehlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d1b9e.2:

Click to download the PDB-style file with coordinates for d1b9e.2.
(The format of our PDB-style files is described here.)

Timeline for d1b9e.2: