Lineage for d1qiy.6 (1qiy L:,K:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029609Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 3029610Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 3029611Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 3029616Protein Insulin [56996] (3 species)
  7. 3029626Species Human (Homo sapiens) [TaxId:9606] [56998] (63 PDB entries)
    Uniprot P01308
  8. 3029710Domain d1qiy.6: 1qiy L:,K: [43884]
    complexed with cl, iph, zn

Details for d1qiy.6

PDB Entry: 1qiy (more details), 2.3 Å

PDB Description: human insulin hexamers with chain b his mutated to tyr complexed with phenol
PDB Compounds: (K:) insulin A chain, (L:) insulin B chain

SCOPe Domain Sequences for d1qiy.6:

Sequence; same for both SEQRES and ATOM records: (download)

>g1qiy.6 g.1.1.1 (L:,K:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqylcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d1qiy.6:

Click to download the PDB-style file with coordinates for d1qiy.6.
(The format of our PDB-style files is described here.)

Timeline for d1qiy.6: