SCOP 1.57: Domain d1qiy.3: 1qiy F:,E:

Lineage for d1qiy.3 (1qiy F:,E:)

1. Root: SCOP 1.57

2. Class g: Small proteins [56992] (56 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (4 proteins)

6. Protein Insulin [56996] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56998] (47 PDB entries)

8. Domain d1qiy.3: 1qiy F:,E: [43881]

Details for d1qiy.3

PDB Entry: 1qiy, 2.3 Å

PDB Description: human insulin hexamers with chain b his mutated to tyr complexed with phenol

SCOP Domain Sequences for d1qiy.3:

Sequence; same for both SEQRES and ATOM records:

>g1qiy.3 g.1.1.1 (F:,E:) Insulin {Human (Homo sapiens)}
fvnqylcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

Timeline for d1qiy.3:

• d1qiy.3 first appeared (with stable ids) in SCOP 1.55
  
• d1qiy.3 appears in SCOP 1.59
  
• d1qiy.3 appears in the current release, SCOPe 2.08