Class g: Small proteins [56992] (100 folds) |
Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulfide-rich |
Superfamily g.1.1: Insulin-like [56994] (1 family) |
Family g.1.1.1: Insulin-like [56995] (5 proteins) |
Protein Insulin [56996] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [56998] (63 PDB entries) Uniprot P01308 |
Domain d1qiy.2: 1qiy D:,C: [43880] complexed with cl, iph, zn |
PDB Entry: 1qiy (more details), 2.3 Å
SCOPe Domain Sequences for d1qiy.2:
Sequence; same for both SEQRES and ATOM records: (download)
>g1qiy.2 g.1.1.1 (D:,C:) Insulin {Human (Homo sapiens) [TaxId: 9606]} fvnqylcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn
Timeline for d1qiy.2: