Class g: Small proteins [56992] (98 folds) |
Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulfide-rich |
Superfamily g.1.1: Insulin-like [56994] (1 family) |
Family g.1.1.1: Insulin-like [56995] (5 proteins) |
Protein Insulin [56996] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [56998] (63 PDB entries) Uniprot P01308 |
Domain d1qiz.6: 1qiz L:,K: [43878] complexed with cl, rco, zn |
PDB Entry: 1qiz (more details), 2 Å
SCOPe Domain Sequences for d1qiz.6:
Sequence; same for both SEQRES and ATOM records: (download)
>g1qiz.6 g.1.1.1 (L:,K:) Insulin {Human (Homo sapiens) [TaxId: 9606]} fvnqylcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn
Timeline for d1qiz.6: