Lineage for d1qiz.6 (1qiz L:,K:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88228Fold g.1: Insulin-like [56993] (1 superfamily)
  4. 88229Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 88230Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 88235Protein Insulin [56996] (3 species)
  7. 88245Species Human (Homo sapiens) [TaxId:9606] [56998] (47 PDB entries)
  8. 88301Domain d1qiz.6: 1qiz L:,K: [43878]

Details for d1qiz.6

PDB Entry: 1qiz (more details), 2 Å

PDB Description: human insulin hexamers with chain b his mutated to tyr complexed with resorcinol

SCOP Domain Sequences for d1qiz.6:

Sequence; same for both SEQRES and ATOM records: (download)

>g1qiz.6 g.1.1.1 (L:,K:) Insulin {Human (Homo sapiens)}
fvnqylcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d1qiz.6:

Click to download the PDB-style file with coordinates for d1qiz.6.
(The format of our PDB-style files is described here.)

Timeline for d1qiz.6: