Lineage for d1tym.1 (1tym B:,A:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. Protein Insulin [56996] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [56998] (63 PDB entries)
    Uniprot P01308
  8. Domain d1tym.1: 1tym B:,A: [43863]
    complexed with cl, tyl, zn

Details for d1tym.1

PDB Entry: 1tym (more details), 1.9 Å

PDB Description: the structure of a complex of hexameric insulin and 4'-hydroxyacetanilide
PDB Compounds: (A:) insulin, (B:) insulin

SCOPe Domain Sequences for d1tym.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1tym.1 g.1.1.1 (B:,A:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d1tym.1 are not available.

Timeline for d1tym.1:

Domains from other chains:
(mouse over for more information)
d1tym.2, d1tym.2, d1tym.2, d1tym.2