Lineage for d1zeg.2 (1zeg D:,C:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634416Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 2634417Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 2634418Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 2634423Protein Insulin [56996] (3 species)
  7. 2634433Species Human (Homo sapiens) [TaxId:9606] [56998] (63 PDB entries)
    Uniprot P01308
  8. 2634449Domain d1zeg.2: 1zeg D:,C: [43842]
    complexed with cl, iph, zn

Details for d1zeg.2

PDB Entry: 1zeg (more details), 1.6 Å

PDB Description: structure of b28 asp insulin in complex with phenol
PDB Compounds: (C:) insulin, (D:) insulin

SCOPe Domain Sequences for d1zeg.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1zeg.2 g.1.1.1 (D:,C:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqhlcgshlvealylvcgergffytdktXgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d1zeg.2:

Click to download the PDB-style file with coordinates for d1zeg.2.
(The format of our PDB-style files is described here.)

Timeline for d1zeg.2: