Lineage for d1aph.1 (1aph B:,A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634416Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 2634417Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 2634418Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 2634423Protein Insulin [56996] (3 species)
  7. 2634424Species Cow (Bos taurus) [TaxId:9913] [56997] (6 PDB entries)
  8. 2634430Domain d1aph.1: 1aph B:,A: [43834]
    complexed with dce

Details for d1aph.1

PDB Entry: 1aph (more details), 2 Å

PDB Description: conformational changes in cubic insulin crystals in the ph range 7-11
PDB Compounds: (A:) insulin a chain (ph 7), (B:) insulin b chain (ph 7)

SCOPe Domain Sequences for d1aph.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1aph.1 g.1.1.1 (B:,A:) Insulin {Cow (Bos taurus) [TaxId: 9913]}
fvnqhlcgshlvealylvcgergffytpkaXgiveqccasvcslyqlenycn

SCOPe Domain Coordinates for d1aph.1:

Click to download the PDB-style file with coordinates for d1aph.1.
(The format of our PDB-style files is described here.)

Timeline for d1aph.1: