Lineage for d1bph.1 (1bph B:,A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061256Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 1061257Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 1061258Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 1061263Protein Insulin [56996] (3 species)
  7. 1061264Species Cow (Bos taurus) [TaxId:9913] [56997] (6 PDB entries)
  8. 1061269Domain d1bph.1: 1bph B:,A: [43833]
    complexed with dce, na

Details for d1bph.1

PDB Entry: 1bph (more details), 2 Å

PDB Description: conformational changes in cubic insulin crystals in the ph range 7-11
PDB Compounds: (A:) insulin a chain (ph 9), (B:) insulin b chain (ph 9)

SCOPe Domain Sequences for d1bph.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1bph.1 g.1.1.1 (B:,A:) Insulin {Cow (Bos taurus) [TaxId: 9913]}
fvnqhlcgshlvealylvcgergffytpkaXgiveqccasvcslyqlenycn

SCOPe Domain Coordinates for d1bph.1:

Click to download the PDB-style file with coordinates for d1bph.1.
(The format of our PDB-style files is described here.)

Timeline for d1bph.1: