Lineage for d1cph.1 (1cph B:,A:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 746752Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 746753Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 746754Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 746759Protein Insulin [56996] (3 species)
  7. 746760Species Cow (Bos taurus) [TaxId:9913] [56997] (6 PDB entries)
  8. 746763Domain d1cph.1: 1cph B:,A: [43831]
    complexed with dce, na

Details for d1cph.1

PDB Entry: 1cph (more details), 1.9 Å

PDB Description: conformational changes in cubic insulin crystals in the ph range 7-11
PDB Compounds: (A:) insulin (ph 10), (B:) insulin (ph 10)

SCOP Domain Sequences for d1cph.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1cph.1 g.1.1.1 (B:,A:) Insulin {Cow (Bos taurus) [TaxId: 9913]}
fvnqhlcgshlvealylvcgergffytpkaXgiveqccasvcslyqlenycn

SCOP Domain Coordinates for d1cph.1:

Click to download the PDB-style file with coordinates for d1cph.1.
(The format of our PDB-style files is described here.)

Timeline for d1cph.1: