Class g: Small proteins [56992] (100 folds) |
Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulfide-rich |
Superfamily g.1.1: Insulin-like [56994] (1 family) |
Family g.1.1.1: Insulin-like [56995] (5 proteins) |
Protein Insulin [56996] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [56997] (6 PDB entries) |
Domain d1cph.1: 1cph B:,A: [43831] complexed with dce, na |
PDB Entry: 1cph (more details), 1.9 Å
SCOPe Domain Sequences for d1cph.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1cph.1 g.1.1.1 (B:,A:) Insulin {Cow (Bos taurus) [TaxId: 9913]} fvnqhlcgshlvealylvcgergffytpkaXgiveqccasvcslyqlenycn
Timeline for d1cph.1: