Lineage for d1acca_ (1acc A:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1455775Fold f.11: Anthrax protective antigen [56987] (1 superfamily)
    4 domains; I (res. 14-225) and II (226-487) are beta-sandwiches of similar gamma-crystallin like topologies; III (488-594) has a beta-grasp like fold; IV (595-735) has an Ig-like fold
  4. 1455776Superfamily f.11.1: Anthrax protective antigen [56988] (1 family) (S)
  5. 1455777Family f.11.1.1: Anthrax protective antigen [56989] (2 proteins)
  6. 1455778Protein Anthrax protective antigen [56990] (1 species)
  7. 1455779Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [56991] (3 PDB entries)
    Uniprot P13423
  8. 1455780Domain d1acca_: 1acc A: [43828]
    complexed with ca

Details for d1acca_

PDB Entry: 1acc (more details), 2.1 Å

PDB Description: anthrax protective antigen
PDB Compounds: (A:) anthrax protective antigen

SCOPe Domain Sequences for d1acca_:

Sequence, based on SEQRES records: (download)

>d1acca_ f.11.1.1 (A:) Anthrax protective antigen {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
sssqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyfqsaiwsgfikvkk
sdeytfatsadnhvtmwvddqevinkasnsnkirlekgrlyqikiqyqrenptekgldfk
lywtdsqnkkevissdnlqlpelkqkssnsrkkrstsagptvpdrdndgipdslevegyt
vdvknkrtflspwisnihekkgltkyksspekwstasdpysdfekvtgridknvspearh
plvaaypivhvdmeniilsknedqstqntdsetrtiskntstsrthtsevhgnaevhasf
fdiggsvsagfsnsnsstvaidhslslagertwaetmglntadtarlnaniryvntgtap
iynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapialnaqddfsstpit
mnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlpqiqettariif
ngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnlqyqgkditefdfn
fdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnniavgadesvvk
eahrevinssteglllnidkdirkilsgyiveiedteglkevindrydmlnisslrqdgk
tfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngikkilifskkgye
ig

Sequence, based on observed residues (ATOM records): (download)

>d1acca_ f.11.1.1 (A:) Anthrax protective antigen {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
sssqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyfqsaiwsgfikvkk
sdeytfatsadnhvtmwvddqevinsnkirlekgrlyqikiqyqrenptekgldfklywt
dsqnkkevissdnlqlpelkqkssvpdrdndgipdslevegytvdvknkrtflspwisni
hekkgltkyksspekwstasdpysdfekvtgridknvspearhplvaaypivhvdmenii
lsknetiskntstsrthtsevvsagfsnsnsstvaidhslslagglntadtarlnaniry
vntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapialnaqdd
fsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlpqiqe
ttariifngkdlnlverriaavnpsttkpdmtlkealkiafgfnepngnlqyqgkditef
dfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnniavgades
vvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindrydmlnisslrq
dgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngikkilifskk
gyeig

SCOPe Domain Coordinates for d1acca_:

Click to download the PDB-style file with coordinates for d1acca_.
(The format of our PDB-style files is described here.)

Timeline for d1acca_: