SCOPe 2.07: Domain d1svba2: 1svb A:1-302

Lineage for d1svba2 (1svb A:1-302)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
   2 intertwined domains; all-beta and alpha+beta

4. Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families)

5. Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins)

6. Protein Envelope glycoprotein [56985] (2 species)

7. Species Tick-borne encephalitis virus [TaxId:11084] [56986] (2 PDB entries)

8. Domain d1svba2: 1svb A:1-302 [43827]
   Other proteins in same PDB: d1svba1
   complexed with nag

Details for d1svba2

PDB Entry: 1svb, 1.9 Å

PDB Description: envelope glycoprotein from tick-borne encephalitis virus

PDB Compounds: (A:) tick-borne encephalitis virus glycoprotein

SCOPe Domain Sequences for d1svba2:

Sequence; same for both SEQRES and ATOM records:

>d1svba2 f.10.1.1 (A:1-302) Envelope glycoprotein {Tick-borne encephalitis virus [TaxId: 11084]}
srcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreyc
lhaklsdtkvaarcptmgpatlaeehqggtvckrdqsdrgwgnhcglfgkgsivacvkaa
ceakkkatghvydankivytvkvephtgdyvaanethsgrktasftissektiltmgeyg
dvsllcrvasgvdlaqtvileldktvehlptawqvhrdwfndlalpwkhegaqnwnnaer
lvefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmk
gl

Timeline for d1svba2:

• d1svba2 first appeared (with stable ids) in SCOP 1.55, called d1svb_2
  
• d1svba2 appears in SCOPe 2.06
  
• d1svba2 appears in the current release, SCOPe 2.08