Lineage for d1svba2 (1svb A:1-302)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2628446Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2628447Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2628448Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins)
  6. 2628449Protein Envelope glycoprotein [56985] (2 species)
  7. 2628468Species Tick-borne encephalitis virus [TaxId:11084] [56986] (2 PDB entries)
  8. 2628469Domain d1svba2: 1svb A:1-302 [43827]
    Other proteins in same PDB: d1svba1
    complexed with nag

Details for d1svba2

PDB Entry: 1svb (more details), 1.9 Å

PDB Description: envelope glycoprotein from tick-borne encephalitis virus
PDB Compounds: (A:) tick-borne encephalitis virus glycoprotein

SCOPe Domain Sequences for d1svba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svba2 f.10.1.1 (A:1-302) Envelope glycoprotein {Tick-borne encephalitis virus [TaxId: 11084]}
srcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreyc
lhaklsdtkvaarcptmgpatlaeehqggtvckrdqsdrgwgnhcglfgkgsivacvkaa
ceakkkatghvydankivytvkvephtgdyvaanethsgrktasftissektiltmgeyg
dvsllcrvasgvdlaqtvileldktvehlptawqvhrdwfndlalpwkhegaqnwnnaer
lvefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmk
gl

SCOPe Domain Coordinates for d1svba2:

Click to download the PDB-style file with coordinates for d1svba2.
(The format of our PDB-style files is described here.)

Timeline for d1svba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1svba1