SCOP 1.61: Domain d1svb_2: 1svb 1-302

Lineage for d1svb_2 (1svb 1-302)

1. Root: SCOP 1.61

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)

4. Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (1 family)

5. Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (2 proteins)

6. Protein Envelope glycoprotein [56985] (1 species)

7. Species Tick-borne encephalitis virus [TaxId:11084] [56986] (1 PDB entry)

8. Domain d1svb_2: 1svb 1-302 [43827]
   Other proteins in same PDB: d1svb_1

Details for d1svb_2

PDB Entry: 1svb, 1.9 Å

PDB Description: envelope glycoprotein from tick-borne encephalitis virus

SCOP Domain Sequences for d1svb_2:

Sequence; same for both SEQRES and ATOM records:

>d1svb_2 f.10.1.1 (1-302) Envelope glycoprotein {Tick-borne encephalitis virus}
srcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreyc
lhaklsdtkvaarcptmgpatlaeehqggtvckrdqsdrgwgnhcglfgkgsivacvkaa
ceakkkatghvydankivytvkvephtgdyvaanethsgrktasftissektiltmgeyg
dvsllcrvasgvdlaqtvileldktvehlptawqvhrdwfndlalpwkhegaqnwnnaer
lvefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmk
gl

Timeline for d1svb_2:

• d1svb_2 first appeared (with stable ids) in SCOP 1.55
  
• d1svb_2 appears in SCOP 1.59
  
• d1svb_2 appears in SCOP 1.63
  
• d1svb_2 appears in the current release, SCOPe 2.08, called d1svba2