Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) |
Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins) |
Protein Envelope glycoprotein [56985] (2 species) |
Species Tick-borne encephalitis virus [TaxId:11084] [56986] (2 PDB entries) |
Domain d1svba2: 1svb A:1-302 [43827] Other proteins in same PDB: d1svba1 complexed with nag |
PDB Entry: 1svb (more details), 1.9 Å
SCOPe Domain Sequences for d1svba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1svba2 f.10.1.1 (A:1-302) Envelope glycoprotein {Tick-borne encephalitis virus [TaxId: 11084]} srcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreyc lhaklsdtkvaarcptmgpatlaeehqggtvckrdqsdrgwgnhcglfgkgsivacvkaa ceakkkatghvydankivytvkvephtgdyvaanethsgrktasftissektiltmgeyg dvsllcrvasgvdlaqtvileldktvehlptawqvhrdwfndlalpwkhegaqnwnnaer lvefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmk gl
Timeline for d1svba2: