Lineage for d1svba2 (1svb A:1-302)
- Root: SCOPe 2.08
Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) 
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
2 intertwined domains; all-beta and alpha+betaSuperfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) 
Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins) Protein Envelope glycoprotein [56985] (2 species) Species Tick-borne encephalitis virus [TaxId:11084] [56986] (2 PDB entries) 
Domain d1svba2: 1svb A:1-302 [43827]
Other proteins in same PDB: d1svba1
complexed with nag
Details for d1svba2
PDB Entry: 1svb (more details), 1.9 Å
PDB Description: envelope glycoprotein from tick-borne encephalitis virus
PDB Compounds: (A:) tick-borne encephalitis virus glycoproteinSCOPe Domain Sequences for d1svba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1svba2 f.10.1.1 (A:1-302) Envelope glycoprotein {Tick-borne encephalitis virus [TaxId: 11084]}
srcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreyc
lhaklsdtkvaarcptmgpatlaeehqggtvckrdqsdrgwgnhcglfgkgsivacvkaa
ceakkkatghvydankivytvkvephtgdyvaanethsgrktasftissektiltmgeyg
dvsllcrvasgvdlaqtvileldktvehlptawqvhrdwfndlalpwkhegaqnwnnaer
lvefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmk
gl
SCOPe Domain Coordinates for d1svba2:
Click to download the PDB-style file with coordinates for d1svba2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1svba2:
- d1svba2 first appeared (with stable ids) in SCOP 1.55, called d1svb_2
- d1svba2 appears in SCOPe 2.07
View in 3D
