Lineage for d1preb2 (1pre B:85-468)

  1. Root: SCOP 1.57
  2. 87528Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 88202Fold f.8: (Pro)aerolysin, pore-forming lobe [56972] (1 superfamily)
  4. 88203Superfamily f.8.1: (Pro)aerolysin, pore-forming lobe [56973] (1 family) (S)
  5. 88204Family f.8.1.1: (Pro)aerolysin, pore-forming lobe [56974] (1 protein)
  6. 88205Protein (Pro)aerolysin, pore-forming lobe [56975] (1 species)
  7. 88206Species Aeromonas hydrophila [56976] (1 PDB entry)
  8. 88208Domain d1preb2: 1pre B:85-468 [43825]
    Other proteins in same PDB: d1prea1, d1preb1

Details for d1preb2

PDB Entry: 1pre (more details), 2.8 Å

PDB Description: proaerolysin

SCOP Domain Sequences for d1preb2:

Sequence, based on SEQRES records: (download)

>d1preb2 f.8.1.1 (B:85-468) (Pro)aerolysin, pore-forming lobe {Aeromonas hydrophila}
iptlsaldipdgdevdvqwrlvhdsanfikptsylahylgyawvggnhsqyvgedmdvtr
dgdgwvirgnndggcdgyrcgdktaikvsnfaynldpdsfkhgdvtqsdrqlvktvvgwa
vndsdtpqsgydvtlrydtatnwsktntyglsekvttknkfkwplvgetelsieiaanqs
wasqnggstttslsqsvrptvparskipvkielykadisypyefkadvsydltlsgflrw
ggnawythpdnrpnwnhtfvigpykdkassiryqwdkryipgevkwwdwnwtiqqnglst
mqnnlarvlrpvragitgdfsaesqfagnieigapvplaadskvrrarsvdgagqglrle
ipldaqelsglgfnnvslsvtpaa

Sequence, based on observed residues (ATOM records): (download)

>d1preb2 f.8.1.1 (B:85-468) (Pro)aerolysin, pore-forming lobe {Aeromonas hydrophila}
iptlsaldipdgdevdvqwrlvhdsanfikptsylahylgyawvggnhsqyvgedmdvtr
dgdgwvirgnndggcdgyrcgdktaikvsnfaynldpdsfkhgdvtqsdrqlvktvvgwa
vndsdtpqsgydvtlrydtatnwsktntyglsekvttknkfkwplvgetelsieiaanqs
wasqnggstttslsqsvrptvparskipvkielykadisypyefkadvsydltlsgflrw
ggnawythpdnrpnwnhtfvigpykdkassiryqwdkryipgevkwwdwnwtiqqnglst
mqnnlarvlrpvragitgdfsaesqfagnieigapvplaalrleipldaqelsglgfnnv
slsvtpaa

SCOP Domain Coordinates for d1preb2:

Click to download the PDB-style file with coordinates for d1preb2.
(The format of our PDB-style files is described here.)

Timeline for d1preb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1preb1