SCOP 1.73: Domain d7ahlg_: 7ahl G:

Lineage for d7ahlg_ (7ahl G:)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.6: Leukocidin-like [56958] (1 superfamily)
   subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel

4. Superfamily f.6.1: Leukocidin-like [56959] (2 families)

5. Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (4 proteins)
   heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit

6. Protein Alpha-hemolysin [56961] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [56962] (1 PDB entry)

8. Domain d7ahlg_: 7ahl G: [43818]

Details for d7ahlg_

PDB Entry: 7ahl, 1.9 Å

PDB Description: alpha-hemolysin from staphylococcus aureus

PDB Compounds: (G:) alpha-hemolysin

SCOP Domain Sequences for d7ahlg_:

Sequence; same for both SEQRES and ATOM records:

>d7ahlg_ f.6.1.1 (G:) Alpha-hemolysin {Staphylococcus aureus [TaxId: 1280]}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn

Timeline for d7ahlg_:

• d7ahlg_ first appeared (with stable ids) in SCOP 1.55
  
• d7ahlg_ appears in SCOP 1.71
  
• d7ahlg_ appears in SCOP 1.75
  
• d7ahlg_ appears in the current release, SCOPe 2.08