Lineage for d7ahlf_ (7ahl F:)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 619706Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 619707Superfamily f.6.1: Leukocidin-like [56959] (2 families) (S)
  5. 619708Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (4 proteins)
    heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
  6. 619709Protein Alpha-hemolysin [56961] (1 species)
  7. 619710Species Staphylococcus aureus [TaxId:1280] [56962] (1 PDB entry)
  8. 619716Domain d7ahlf_: 7ahl F: [43817]

Details for d7ahlf_

PDB Entry: 7ahl (more details), 1.9 Å

PDB Description: alpha-hemolysin from staphylococcus aureus

SCOP Domain Sequences for d7ahlf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ahlf_ f.6.1.1 (F:) Alpha-hemolysin {Staphylococcus aureus}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn

SCOP Domain Coordinates for d7ahlf_:

Click to download the PDB-style file with coordinates for d7ahlf_.
(The format of our PDB-style files is described here.)

Timeline for d7ahlf_: