Lineage for d7ahlc_ (7ahl C:)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 425721Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 425722Superfamily f.6.1: Leukocidin-like [56959] (2 families) (S)
  5. 425723Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (3 proteins)
    heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
  6. 425724Protein Alpha-hemolysin [56961] (1 species)
  7. 425725Species Staphylococcus aureus [TaxId:1280] [56962] (1 PDB entry)
  8. 425728Domain d7ahlc_: 7ahl C: [43814]

Details for d7ahlc_

PDB Entry: 7ahl (more details), 1.9 Å

PDB Description: alpha-hemolysin from staphylococcus aureus

SCOP Domain Sequences for d7ahlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ahlc_ f.6.1.1 (C:) Alpha-hemolysin {Staphylococcus aureus}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn

SCOP Domain Coordinates for d7ahlc_:

Click to download the PDB-style file with coordinates for d7ahlc_.
(The format of our PDB-style files is described here.)

Timeline for d7ahlc_: