Lineage for d1ek9c_ (1ek9 C:)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 39326Fold f.5: Integral outer membrane protein TolC, efflux pump component [56953] (1 superfamily)
  4. 39327Superfamily f.5.1: Integral outer membrane protein TolC, efflux pump component [56954] (1 family) (S)
  5. 39328Family f.5.1.1: Integral outer membrane protein TolC, efflux pump component [56955] (1 protein)
  6. 39329Protein Integral outer membrane protein TolC, efflux pump component [56956] (1 species)
  7. 39330Species Escherichia coli [TaxId:562] [56957] (1 PDB entry)
  8. 39333Domain d1ek9c_: 1ek9 C: [43811]

Details for d1ek9c_

PDB Entry: 1ek9 (more details), 2.1 Å

PDB Description: 2.1a x-ray structure of tolc: an integral outer membrane protein and efflux pump component from escherichia coli

SCOP Domain Sequences for d1ek9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ek9c_ f.5.1.1 (C:) Integral outer membrane protein TolC, efflux pump component {Escherichia coli}
enlmqvyqqarlsnpelrksaadrdaafekinearspllpqlglgadytysngyrdangi
nsnatsaslqltqsifdmskwraltlqekaagiqdvtyqtdqqtlilntatayfnvlnai
dvlsytqaqkeaiyrqldqttqrfnvglvaitdvqnaraqydtvlaneltarnnldnave
qlrqitgnyypelaalnvenfktdkpqpvnallkeaekrnlsllqarlsqdlareqirqa
qdghlptldltastgisdtsysgsktrgaagtqyddsnmgqnkvglsfslpiyqggmvns
qvkqaqynfvgaseqlesahrsvvqtvrssfnninasissinaykqavvsaqssldamea
gysvgtrtivdvldatttlynakqelanarynylinqlniksalgtlneqdllalnnals
kpvstnpe

SCOP Domain Coordinates for d1ek9c_:

Click to download the PDB-style file with coordinates for d1ek9c_.
(The format of our PDB-style files is described here.)

Timeline for d1ek9c_: