Lineage for d1qjqa_ (1qjq A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2251383Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2251501Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2251661Family f.4.3.3: Ligand-gated protein channel [56948] (5 proteins)
    monomeric (22,24) barrel; ~150 N-terminal residues form a "plug" or "cork" subdomain
  6. 2251665Protein Ferric hydroxamate uptake receptor FhuA [56949] (1 species)
  7. 2251666Species Escherichia coli [TaxId:562] [56950] (10 PDB entries)
  8. 2251673Domain d1qjqa_: 1qjq A: [43806]
    complexed with dpo, ftt, ni, pfc, po4

Details for d1qjqa_

PDB Entry: 1qjq (more details), 2.95 Å

PDB Description: ferric hydroxamate receptor from escherichia coli (fhua)
PDB Compounds: (A:) ferric hydroxamate receptor

SCOPe Domain Sequences for d1qjqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjqa_ f.4.3.3 (A:) Ferric hydroxamate uptake receptor FhuA {Escherichia coli [TaxId: 562]}
esawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvsv
gtrgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvsv
lygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltgla
rsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplpn
gkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygvc
sdpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltgv
dfmrmrndinawfgyddsvpllnlynpsshhhhhhgssvntdfdfnakdpansgpyriln
kqkqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfd
ngvtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktn
nlmadpegsffsveggeirargveieakaalsasvnvvgsytytdaeyttdttykgntpa
qvpkhmaslwadytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydla
rvgmagsnvalhvnnlfdreyvascfntygcfwgaerqvvatatfrf

SCOPe Domain Coordinates for d1qjqa_:

Click to download the PDB-style file with coordinates for d1qjqa_.
(The format of our PDB-style files is described here.)

Timeline for d1qjqa_: