Lineage for d1qjqa_ (1qjq A:)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 39230Fold f.4: Transmembrane beta-barrels [56924] (3 superfamilies)
  4. 39248Superfamily f.4.3: Porins [56935] (3 families) (S)
  5. 39312Family f.4.3.3: Ligand-gated protein channel [56948] (2 proteins)
  6. 39316Protein Ferric hydroxamate uptake receptor FhuA [56949] (1 species)
  7. 39317Species Escherichia coli [TaxId:562] [56950] (8 PDB entries)
  8. 39324Domain d1qjqa_: 1qjq A: [43806]

Details for d1qjqa_

PDB Entry: 1qjq (more details), 2.95 Å

PDB Description: ferric hydroxamate receptor from escherichia coli (fhua)

SCOP Domain Sequences for d1qjqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjqa_ f.4.3.3 (A:) Ferric hydroxamate uptake receptor FhuA {Escherichia coli}
esawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvsv
gtrgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvsv
lygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltgla
rsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplpn
gkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygvc
sdpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltgv
dfmrmrndinawfgyddsvpllnlynpsshhhhhhgssvntdfdfnakdpansgpyriln
kqkqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfd
ngvtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktn
nlmadpegsffsveggeirargveieakaalsasvnvvgsytytdaeyttdttykgntpa
qvpkhmaslwadytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydla
rvgmagsnvalhvnnlfdreyvascfntygcfwgaerqvvatatfrf

SCOP Domain Coordinates for d1qjqa_:

Click to download the PDB-style file with coordinates for d1qjqa_.
(The format of our PDB-style files is described here.)

Timeline for d1qjqa_: