Lineage for d1fcpa_ (1fcp A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2627486Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2627626Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2627820Family f.4.3.3: Ligand-gated protein channel [56948] (5 proteins)
    monomeric (22,24) barrel; ~150 N-terminal residues form a "plug" or "cork" subdomain
  6. 2627824Protein Ferric hydroxamate uptake receptor FhuA [56949] (1 species)
  7. 2627825Species Escherichia coli [TaxId:562] [56950] (10 PDB entries)
  8. 2627833Domain d1fcpa_: 1fcp A: [43805]
    complexed with aae, ea2, fci, lil, lim, ni

Details for d1fcpa_

PDB Entry: 1fcp (more details), 2.7 Å

PDB Description: ferric hydroxamate uptake receptor (fhua) from e.coli in complex with bound ferrichrome-iron
PDB Compounds: (A:) protein (ferric hydroxamate uptake receptor)

SCOPe Domain Sequences for d1fcpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcpa_ f.4.3.3 (A:) Ferric hydroxamate uptake receptor FhuA {Escherichia coli [TaxId: 562]}
esawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvsv
gtrgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvsv
lygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltgla
rsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplpn
gkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygvc
sdpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltgv
dfmrmrndinawfgyddsvpllnlynpshhhhhhgsvntdfdfnakdpansgpyrilnkq
kqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfdng
vtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktnnl
madpegsffsveggeirargveieakaalsasvnvvgsytytdaeyttdttykgntpaqv
pkhmaslwadytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydlarv
gmagsnvalhvnnlfdreyvascfntygcfwgaerqvvatatfrf

SCOPe Domain Coordinates for d1fcpa_:

Click to download the PDB-style file with coordinates for d1fcpa_.
(The format of our PDB-style files is described here.)

Timeline for d1fcpa_: