Lineage for d1qffa_ (1qff A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3022096Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 3022290Family f.4.3.3: Ligand-gated protein channel [56948] (5 proteins)
    monomeric (22,24) barrel; ~150 N-terminal residues form a "plug" or "cork" subdomain
  6. 3022294Protein Ferric hydroxamate uptake receptor FhuA [56949] (1 species)
  7. 3022295Species Escherichia coli [TaxId:562] [56950] (10 PDB entries)
  8. 3022300Domain d1qffa_: 1qff A: [43804]
    complex with bound ferrichrome-iron
    complexed with dao, ddq, dpo, eap, fci, ftt, myr, po4

Details for d1qffa_

PDB Entry: 1qff (more details), 2.7 Å

PDB Description: e. coli ferric hydroxamate uptake receptor (fhua) in complex with bound ferrichrome-iron
PDB Compounds: (A:) ferric hydroxamate uptake receptor

SCOPe Domain Sequences for d1qffa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qffa_ f.4.3.3 (A:) Ferric hydroxamate uptake receptor FhuA {Escherichia coli [TaxId: 562]}
esawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvsv
gtrgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvsv
lygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltgla
rsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplpn
gkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygvc
sdpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltgv
dfmrmrndinawfgyddsvpllnlynpsshhhhhhgssvntdfdfnakdpansgpyriln
kqkqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfd
ngvtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktn
nlmadpegsffsveggeirargveieakaalsasvnvvgsytytdaeyttdttykgntpa
qvpkhmaslwadytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydla
rvgmagsnvalhvnnlfdreyvascfntygcfwgaerqvvatatfrf

SCOPe Domain Coordinates for d1qffa_:

Click to download the PDB-style file with coordinates for d1qffa_.
(The format of our PDB-style files is described here.)

Timeline for d1qffa_: