Lineage for d2fcpa_ (2fcp A:)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 39230Fold f.4: Transmembrane beta-barrels [56924] (3 superfamilies)
  4. 39248Superfamily f.4.3: Porins [56935] (3 families) (S)
  5. 39312Family f.4.3.3: Ligand-gated protein channel [56948] (2 proteins)
  6. 39316Protein Ferric hydroxamate uptake receptor FhuA [56949] (1 species)
  7. 39317Species Escherichia coli [TaxId:562] [56950] (8 PDB entries)
  8. 39320Domain d2fcpa_: 2fcp A: [43802]

Details for d2fcpa_

PDB Entry: 2fcp (more details), 2.5 Å

PDB Description: ferric hydroxamate uptake receptor (fhua) from e.coli

SCOP Domain Sequences for d2fcpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcpa_ f.4.3.3 (A:) Ferric hydroxamate uptake receptor FhuA {Escherichia coli}
esawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvsv
gtrgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvsv
lygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltgla
rsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplpn
gkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygvc
sdpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltgv
dfmrmrndinawfgyddsvpllnlynpshhhhhhgsvntdfdfnakdpansgpyrilnkq
kqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfdng
vtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktnnl
madpegsffsveggeirargveieakaalsasvnvvgsytytdaeyttdttykgntpaqv
pkhmaslwadytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydlarv
gmagsnvalhvnnlfdreyvascfntygcfwgaerqvvatatfrf

SCOP Domain Coordinates for d2fcpa_:

Click to download the PDB-style file with coordinates for d2fcpa_.
(The format of our PDB-style files is described here.)

Timeline for d2fcpa_: