Lineage for d2fcpa_ (2fcp A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3022096Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 3022290Family f.4.3.3: Ligand-gated protein channel [56948] (5 proteins)
    monomeric (22,24) barrel; ~150 N-terminal residues form a "plug" or "cork" subdomain
  6. 3022294Protein Ferric hydroxamate uptake receptor FhuA [56949] (1 species)
  7. 3022295Species Escherichia coli [TaxId:562] [56950] (10 PDB entries)
  8. 3022298Domain d2fcpa_: 2fcp A: [43802]
    complexed with aae, ea2, lil, lim, ni

Details for d2fcpa_

PDB Entry: 2fcp (more details), 2.5 Å

PDB Description: ferric hydroxamate uptake receptor (fhua) from e.coli
PDB Compounds: (A:) protein (ferric hydroxamate uptake receptor)

SCOPe Domain Sequences for d2fcpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcpa_ f.4.3.3 (A:) Ferric hydroxamate uptake receptor FhuA {Escherichia coli [TaxId: 562]}
esawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvsv
gtrgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvsv
lygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltgla
rsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplpn
gkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygvc
sdpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltgv
dfmrmrndinawfgyddsvpllnlynpshhhhhhgsvntdfdfnakdpansgpyrilnkq
kqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfdng
vtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktnnl
madpegsffsveggeirargveieakaalsasvnvvgsytytdaeyttdttykgntpaqv
pkhmaslwadytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydlarv
gmagsnvalhvnnlfdreyvascfntygcfwgaerqvvatatfrf

SCOPe Domain Coordinates for d2fcpa_:

Click to download the PDB-style file with coordinates for d2fcpa_.
(The format of our PDB-style files is described here.)

Timeline for d2fcpa_: