Lineage for d1by3a_ (1by3 A:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. Family f.4.3.3: Ligand-gated protein channel [56948] (5 proteins)
    monomeric (22,24) barrel; ~150 N-terminal residues form a "plug" or "cork" subdomain
  6. Protein Ferric hydroxamate uptake receptor FhuA [56949] (1 species)
  7. Species Escherichia coli [TaxId:562] [56950] (10 PDB entries)
  8. Domain d1by3a_: 1by3 A: [43801]
    complexed with oes

Details for d1by3a_

PDB Entry: 1by3 (more details), 2.74 Å

PDB Description: fhua from e. coli
PDB Compounds: (A:) protein (ferrichrome-iron receptor precursor (fhua))

SCOPe Domain Sequences for d1by3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1by3a_ f.4.3.3 (A:) Ferric hydroxamate uptake receptor FhuA {Escherichia coli [TaxId: 562]}
sawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvsvg
trgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvsvl
ygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltglar
sanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplpng
krlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygvcs
dpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltgvd
fmrmrndinawfgyddsvpllnlynpvntdfdfnakdpansgpyrilnkqkqtgvyvqdq
aqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfdngvtpyfsyses
fepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktnnlmadpegsffs
veggeirargveieakrplsasvnvvgsytytdaeyttdttykgntpaqvpkhmaslwad
ytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydlarvgmagsnvalh
vnnlfdreyvascfntygcfwgaerqvvatatfrf

SCOPe Domain Coordinates for d1by3a_ are not available.

Timeline for d1by3a_: