Lineage for d1by5a_ (1by5 A:)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 39230Fold f.4: Transmembrane beta-barrels [56924] (3 superfamilies)
  4. 39248Superfamily f.4.3: Porins [56935] (3 families) (S)
  5. 39312Family f.4.3.3: Ligand-gated protein channel [56948] (2 proteins)
  6. 39316Protein Ferric hydroxamate uptake receptor FhuA [56949] (1 species)
  7. 39317Species Escherichia coli [TaxId:562] [56950] (8 PDB entries)
  8. 39318Domain d1by5a_: 1by5 A: [43800]

Details for d1by5a_

PDB Entry: 1by5 (more details), 2.6 Å

PDB Description: fhua from e. coli, with its ligand ferrichrome

SCOP Domain Sequences for d1by5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1by5a_ f.4.3.3 (A:) Ferric hydroxamate uptake receptor FhuA {Escherichia coli}
qesawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvs
vgtrgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvs
vlygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltgl
arsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplp
ngkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygv
csdpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltg
vdfmrmrndinawfgyddsvpllnlynpvntdfdfnakdpansgpyrilnkqkqtgvyvq
dqaqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfdngvtpyfsys
esfepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktnnlmadpegsf
fsveggeirargveieakrplsasvnvvgsytytdaeyttdttykgntpaqvpkhmaslw
adytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydlarvgmagsnva
lhvnnlfdreyvascfntygcfwgaerqvvatatfrf

SCOP Domain Coordinates for d1by5a_:

Click to download the PDB-style file with coordinates for d1by5a_.
(The format of our PDB-style files is described here.)

Timeline for d1by5a_: