SCOPe 2.08: Domain d1a0tq_: 1a0t Q:

Lineage for d1a0tq_ (1a0t Q:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.4.3: Porins [56935] (5 families)

5. Family f.4.3.2: Maltoporin-like [56942] (2 proteins)
   trimer, one subunit folds into (18,22) barrel
   automatically mapped to Pfam PF02264

6. Protein Sucrose-specific porin [56946] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [56947] (3 PDB entries)

8. Domain d1a0tq_: 1a0t Q: [43795]
   complexed with ca

Details for d1a0tq_

PDB Entry: 1a0t, 2.4 Å

PDB Description: sucrose-specific porin, with bound sucrose molecules

PDB Compounds: (Q:) sucrose-specific porin

SCOPe Domain Sequences for d1a0tq_:

Sequence; same for both SEQRES and ATOM records:

>d1a0tq_ f.4.3.2 (Q:) Sucrose-specific porin {Salmonella typhimurium [TaxId: 90371]}
sgfefhgyarsgvimndsgastksgayitpagetggaigrlgnqadtyvemnlehkqtld
ngattrfkvmvadgqtsyndwtastsdlnvrqafvelgnlptfagpfkgstlwagkrfdr
dnfdihwidsdvvflagtgggiydvkwndglrsnfslygrnfgdiddssnsvqnyiltmn
hfagplqmmvsglrakdnderkdsngnlakgdaantgvhallglhndsfyglrdgsskta
llyghglgaevkgigsdgalrpgadtwriasygttplsenwsvapamlaqrskdryadgd
syqwatfnlrliqainqnfalayegsyqymdlkpegyndrqavngsfykltfaptfkvgs
igdffsrpeirfytswmdwskklnnyasddalgsdgfnsggewsfgvqmetwf

Timeline for d1a0tq_:

• d1a0tq_ first appeared (with stable ids) in SCOP 1.55
  
• d1a0tq_ appears in SCOPe 2.07