Lineage for d1osmc_ (1osm C:)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 744694Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 744736Superfamily f.4.3: Porins [56935] (4 families) (S)
  5. 744737Family f.4.3.1: Porin [56936] (1 protein)
    trimer, one subunit folds into (16,20) barrel
  6. 744738Protein Porin [56937] (5 species)
  7. 744762Species Klebsiella pneumoniae [TaxId:573] [56941] (1 PDB entry)
  8. 744765Domain d1osmc_: 1osm C: [43771]
    osmoporin ompk36
    complexed with d12

Details for d1osmc_

PDB Entry: 1osm (more details), 3.2 Å

PDB Description: osmoporin (ompk36) from klebsiella pneumoniae
PDB Compounds: (C:) ompk36

SCOP Domain Sequences for d1osmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1osmc_ f.4.3.1 (C:) Porin {Klebsiella pneumoniae [TaxId: 573]}
aeiynkdgnkldlygkidglhyfsddkdvdgdqtymrlgvkgetqindqltgygqweynv
qanntesssdqawtrlafaglkfgdagsfdygrnygvvydvtswtdvlpefggdtygsdn
flqsrangvatyrnsdffglvdglnfalqyqgkngsvsgegatnngrgalkqngdgfgts
vtydifdgisagfayanskrtddqnqlllgegdhaetytgglkydanniylatqytqtyn
atragslgfankaqnfevaaqyqfdfglrpsvaylqskgkdlngygdqdilkyvdvgaty
yfnknmstyvdykinllddnsftrsagistddvvalglvyqf

SCOP Domain Coordinates for d1osmc_:

Click to download the PDB-style file with coordinates for d1osmc_.
(The format of our PDB-style files is described here.)

Timeline for d1osmc_: