Lineage for d7prna_ (7prn A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2627486Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2627626Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2627627Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 2627628Protein Porin [56937] (5 species)
  7. 2627692Species Rhodopseudomonas blastica, strain DSM2131 [TaxId:1075] [56940] (9 PDB entries)
  8. 2627700Domain d7prna_: 7prn A: [43768]
    complexed with c8e; mutant

Details for d7prna_

PDB Entry: 7prn (more details), 2.25 Å

PDB Description: e1m, d97a, e99a mutant of rh. blastica porin
PDB Compounds: (A:) porin

SCOPe Domain Sequences for d7prna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7prna_ f.4.3.1 (A:) Porin {Rhodopseudomonas blastica, strain DSM2131 [TaxId: 1075]}
mislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaklrmqwddgda
fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltyasamgyeassfgdaqssffaynsk
ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa
yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray
vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf

SCOPe Domain Coordinates for d7prna_:

Click to download the PDB-style file with coordinates for d7prna_.
(The format of our PDB-style files is described here.)

Timeline for d7prna_: