Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) |
Superfamily f.4.3: Porins [56935] (4 families) |
Family f.4.3.1: Porin [56936] (1 protein) trimer, one subunit folds into (16,20) barrel |
Protein Porin [56937] (5 species) |
Species Rhodopseudomonas blastica, strain DSM2131 [TaxId:1075] [56940] (9 PDB entries) |
Domain d1bh3a_: 1bh3 A: [43766] complexed with c8e; mutant |
PDB Entry: 1bh3 (more details), 2.19 Å
SCOP Domain Sequences for d1bh3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bh3a_ f.4.3.1 (A:) Porin {Rhodopseudomonas blastica, strain DSM2131 [TaxId: 1075]} mislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaklrmqwddgda fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltydsemgyeassfgdaqssffkynsk ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf
Timeline for d1bh3a_: