Lineage for d1bh3a_ (1bh3 A:)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 886206Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 886252Superfamily f.4.3: Porins [56935] (4 families) (S)
  5. 886253Family f.4.3.1: Porin [56936] (1 protein)
    trimer, one subunit folds into (16,20) barrel
  6. 886254Protein Porin [56937] (5 species)
  7. 886288Species Rhodopseudomonas blastica, strain DSM2131 [TaxId:1075] [56940] (9 PDB entries)
  8. 886294Domain d1bh3a_: 1bh3 A: [43766]
    complexed with c8e; mutant

Details for d1bh3a_

PDB Entry: 1bh3 (more details), 2.19 Å

PDB Description: e1m, a116k mutant of rh. blastica porin
PDB Compounds: (A:) porin

SCOP Domain Sequences for d1bh3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bh3a_ f.4.3.1 (A:) Porin {Rhodopseudomonas blastica, strain DSM2131 [TaxId: 1075]}
mislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaklrmqwddgda
fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltydsemgyeassfgdaqssffkynsk
ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa
yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray
vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf

SCOP Domain Coordinates for d1bh3a_:

Click to download the PDB-style file with coordinates for d1bh3a_.
(The format of our PDB-style files is described here.)

Timeline for d1bh3a_: