Lineage for d1bh3__ (1bh3 -)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 39230Fold f.4: Transmembrane beta-barrels [56924] (3 superfamilies)
  4. 39248Superfamily f.4.3: Porins [56935] (3 families) (S)
  5. 39249Family f.4.3.1: Porin [56936] (1 protein)
  6. 39250Protein Porin [56937] (4 species)
  7. 39269Species Rhodopseudomonas blastica, strain DSM2131 [TaxId:1075] [56940] (8 PDB entries)
  8. 39275Domain d1bh3__: 1bh3 - [43766]

Details for d1bh3__

PDB Entry: 1bh3 (more details), 2.19 Å

PDB Description: e1m, a116k mutant of rh. blastica porin

SCOP Domain Sequences for d1bh3__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bh3__ f.4.3.1 (-) Porin {Rhodopseudomonas blastica, strain DSM2131}
mislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaklrmqwddgda
fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltydsemgyeassfgdaqssffkynsk
ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa
yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray
vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf

SCOP Domain Coordinates for d1bh3__:

Click to download the PDB-style file with coordinates for d1bh3__.
(The format of our PDB-style files is described here.)

Timeline for d1bh3__: