SCOP 1.75: Domain d5prna_: 5prn A:

Lineage for d5prna_ (5prn A:)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)

4. Superfamily f.4.3: Porins [56935] (4 families)

5. Family f.4.3.1: Porin [56936] (1 protein)
   trimer, one subunit folds into (16,20) barrel

6. Protein Porin [56937] (5 species)

7. Species Rhodopseudomonas blastica, strain DSM2131 [TaxId:1075] [56940] (9 PDB entries)

8. Domain d5prna_: 5prn A: [43764]
   complexed with c8e; mutant

Details for d5prna_

PDB Entry: 5prn, 2 Å

PDB Description: e1m, y96w, s119w mutant of rh. blastica porin

PDB Compounds: (A:) porin

SCOP Domain Sequences for d5prna_:

Sequence; same for both SEQRES and ATOM records:

>d5prna_ f.4.3.1 (A:) Porin {Rhodopseudomonas blastica, strain DSM2131 [TaxId: 1075]}
mislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaklrmqwddgda
fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltwdsemgyeassfgdaqssffaynwk
ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa
yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray
vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf

Timeline for d5prna_:

• d5prna_ first appeared (with stable ids) in SCOP 1.55, called d5prn__
  
• d5prna_ appears in SCOP 1.73
  
• d5prna_ appears in SCOPe 2.01
  
• d5prna_ appears in the current release, SCOPe 2.08