Lineage for d2prna_ (2prn A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2251383Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2251501Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2251502Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 2251503Protein Porin [56937] (5 species)
  7. 2251563Species Rhodopseudomonas blastica, strain DSM2131 [TaxId:1075] [56940] (9 PDB entries)
  8. 2251567Domain d2prna_: 2prn A: [43763]
    complexed with c8e, mg; mutant

Details for d2prna_

PDB Entry: 2prn (more details), 1.93 Å

PDB Description: rhodopseudomonas blastica porin, triple mutant e1m, e99w, a116w
PDB Compounds: (A:) porin

SCOPe Domain Sequences for d2prna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2prna_ f.4.3.1 (A:) Porin {Rhodopseudomonas blastica, strain DSM2131 [TaxId: 1075]}
mislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaklrmqwddgda
fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltydswmgyeassfgdaqssffwynsk
ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa
yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray
vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf

SCOPe Domain Coordinates for d2prna_:

Click to download the PDB-style file with coordinates for d2prna_.
(The format of our PDB-style files is described here.)

Timeline for d2prna_: