![]() | Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
![]() | Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) |
![]() | Superfamily f.4.3: Porins [56935] (4 families) ![]() |
![]() | Family f.4.3.1: Porin [56936] (1 protein) trimer, one subunit folds into (16,20) barrel |
![]() | Protein Porin [56937] (5 species) |
![]() | Species Rhodopseudomonas blastica, strain DSM2131 [TaxId:1075] [56940] (9 PDB entries) |
![]() | Domain d2prna_: 2prn A: [43763] complexed with c8e, mg; mutant |
PDB Entry: 2prn (more details), 1.93 Å
SCOP Domain Sequences for d2prna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2prna_ f.4.3.1 (A:) Porin {Rhodopseudomonas blastica, strain DSM2131 [TaxId: 1075]} mislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaklrmqwddgda fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltydswmgyeassfgdaqssffwynsk ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf
Timeline for d2prna_: