SCOP 1.71: Domain d2prn__: 2prn -

Lineage for d2prn__ (2prn -)

1. Root: SCOP 1.71

2. Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)

4. Superfamily f.4.3: Porins [56935] (4 families)

5. Family f.4.3.1: Porin [56936] (1 protein)
   trimer, one subunit folds into (16,20) barrel

6. Protein Porin [56937] (5 species)

7. Species Rhodopseudomonas blastica, strain DSM2131 [TaxId:1075] [56940] (9 PDB entries)

8. Domain d2prn__: 2prn - [43763]
   complexed with c8e, mg; mutant

Details for d2prn__

PDB Entry: 2prn, 1.93 Å

PDB Description: rhodopseudomonas blastica porin, triple mutant e1m, e99w, a116w

SCOP Domain Sequences for d2prn__:

Sequence; same for both SEQRES and ATOM records:

>d2prn__ f.4.3.1 (-) Porin {Rhodopseudomonas blastica, strain DSM2131}
mislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaklrmqwddgda
fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltydswmgyeassfgdaqssffwynsk
ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa
yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray
vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf

Timeline for d2prn__:

• d2prn__ first appeared (with stable ids) in SCOP 1.55
  
• d2prn__ appears in SCOP 1.69
  
• d2prn__ is called d2prna_ in SCOP 1.73
  
• d2prn__ appears in the current release, SCOPe 2.08, called d2prna_