Lineage for d2prn__ (2prn -)
- Root: SCOP 1.55
Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) 
Fold f.4: Transmembrane beta-barrels [56924] (3 superfamilies) 
Superfamily f.4.3: Porins [56935] (3 families) 
Family f.4.3.1: Porin [56936] (1 protein) Protein Porin [56937] (4 species) 
Species Rhodopseudomonas blastica, strain DSM2131 [TaxId:1075] [56940] (8 PDB entries) 
Domain d2prn__: 2prn - [43763]
Details for d2prn__
PDB Entry: 2prn (more details), 1.93 Å
PDB Description: rhodopseudomonas blastica porin, triple mutant e1m, e99w, a116w
SCOP Domain Sequences for d2prn__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2prn__ f.4.3.1 (-) Porin {Rhodopseudomonas blastica, strain DSM2131}
mislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaklrmqwddgda
fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltydswmgyeassfgdaqssffwynsk
ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa
yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray
vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf
SCOP Domain Coordinates for d2prn__:
Click to download the PDB-style file with coordinates for d2prn__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2prn__:
- d2prn__ appears in SCOP 1.57
- d2prn__ appears in the current release, SCOPe 2.08, called d2prna_
View in 3D