SCOPe 2.08: Domain d2prna_: 2prn A:

Lineage for d2prna_ (2prn A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.4.3: Porins [56935] (5 families)

5. Family f.4.3.1: Porin [56936] (2 proteins)
   trimer, one subunit folds into (16,20) barrel

6. Protein Porin [56937] (5 species)

7. Species Rhodopseudomonas blastica, strain DSM2131 [TaxId:1075] [56940] (9 PDB entries)

8. Domain d2prna_: 2prn A: [43763]
   complexed with c8e, mg; mutant

Details for d2prna_

PDB Entry: 2prn, 1.93 Å

PDB Description: rhodopseudomonas blastica porin, triple mutant e1m, e99w, a116w

PDB Compounds: (A:) porin

SCOPe Domain Sequences for d2prna_:

Sequence; same for both SEQRES and ATOM records:

>d2prna_ f.4.3.1 (A:) Porin {Rhodopseudomonas blastica, strain DSM2131 [TaxId: 1075]}
mislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaklrmqwddgda
fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltydswmgyeassfgdaqssffwynsk
ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa
yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray
vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf

Timeline for d2prna_:

• d2prna_ first appeared (with stable ids) in SCOP 1.55, called d2prn__
  
• d2prna_ appears in SCOPe 2.07