Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) |
Superfamily f.4.3: Porins [56935] (5 families) |
Family f.4.3.1: Porin [56936] (2 proteins) trimer, one subunit folds into (16,20) barrel |
Protein Porin [56937] (5 species) |
Species Rhodopseudomonas blastica, strain DSM2131 [TaxId:1075] [56940] (9 PDB entries) |
Domain d3prna_: 3prn A: [43761] complexed with c8e, mg; mutant |
PDB Entry: 3prn (more details), 1.9 Å
SCOPe Domain Sequences for d3prna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3prna_ f.4.3.1 (A:) Porin {Rhodopseudomonas blastica, strain DSM2131 [TaxId: 1075]} mislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaklrmqwddgda fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltydsemgyewssfgdaqssffaynsk ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf
Timeline for d3prna_: