Lineage for d3prna_ (3prn A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2251383Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2251501Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2251502Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 2251503Protein Porin [56937] (5 species)
  7. 2251563Species Rhodopseudomonas blastica, strain DSM2131 [TaxId:1075] [56940] (9 PDB entries)
  8. 2251564Domain d3prna_: 3prn A: [43761]
    complexed with c8e, mg; mutant

Details for d3prna_

PDB Entry: 3prn (more details), 1.9 Å

PDB Description: e1m, a104w mutant of rh. blastica porin
PDB Compounds: (A:) porin

SCOPe Domain Sequences for d3prna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3prna_ f.4.3.1 (A:) Porin {Rhodopseudomonas blastica, strain DSM2131 [TaxId: 1075]}
mislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaklrmqwddgda
fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltydsemgyewssfgdaqssffaynsk
ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa
yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray
vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf

SCOPe Domain Coordinates for d3prna_:

Click to download the PDB-style file with coordinates for d3prna_.
(The format of our PDB-style files is described here.)

Timeline for d3prna_: