Class f: Membrane and cell surface proteins and peptides [56835] (49 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) |
Superfamily f.4.3: Porins [56935] (4 families) |
Family f.4.3.1: Porin [56936] (1 protein) trimer, one subunit folds into (16,20) barrel |
Protein Porin [56937] (5 species) |
Species Rhodopseudomonas blastica, strain DSM2131 [TaxId:1075] [56940] (9 PDB entries) |
Domain d3prn__: 3prn - [43761] complexed with c8e, mg; mutant |
PDB Entry: 3prn (more details), 1.9 Å
SCOP Domain Sequences for d3prn__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3prn__ f.4.3.1 (-) Porin {Rhodopseudomonas blastica, strain DSM2131} mislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaklrmqwddgda fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltydsemgyewssfgdaqssffaynsk ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf
Timeline for d3prn__: