SCOP 1.71: Domain d3prn__: 3prn -

Lineage for d3prn__ (3prn -)

1. Root: SCOP 1.71

2. Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)

4. Superfamily f.4.3: Porins [56935] (4 families)

5. Family f.4.3.1: Porin [56936] (1 protein)
   trimer, one subunit folds into (16,20) barrel

6. Protein Porin [56937] (5 species)

7. Species Rhodopseudomonas blastica, strain DSM2131 [TaxId:1075] [56940] (9 PDB entries)

8. Domain d3prn__: 3prn - [43761]
   complexed with c8e, mg; mutant

Details for d3prn__

PDB Entry: 3prn, 1.9 Å

PDB Description: e1m, a104w mutant of rh. blastica porin

SCOP Domain Sequences for d3prn__:

Sequence; same for both SEQRES and ATOM records:

>d3prn__ f.4.3.1 (-) Porin {Rhodopseudomonas blastica, strain DSM2131}
mislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaklrmqwddgda
fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltydsemgyewssfgdaqssffaynsk
ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa
yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray
vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf

Timeline for d3prn__:

• d3prn__ first appeared (with stable ids) in SCOP 1.55
  
• d3prn__ appears in SCOP 1.69
  
• d3prn__ is called d3prna_ in SCOP 1.73
  
• d3prn__ appears in the current release, SCOPe 2.08, called d3prna_