Lineage for d3prna_ (3prn A:)
- Root: SCOPe 2.08
Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) 
Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
not a true fold, gathers together transmembrane barrels of different (n,S)
annotated by the SCOP(e) curators as 'not a true fold'
Superfamily f.4.3: Porins [56935] (5 families) 
Family f.4.3.1: Porin [56936] (2 proteins)
trimer, one subunit folds into (16,20) barrel
Protein Porin [56937] (5 species) 
Species Rhodopseudomonas blastica, strain DSM2131 [TaxId:1075] [56940] (9 PDB entries) 
Domain d3prna_: 3prn A: [43761]
complexed with c8e, mg; mutant
Details for d3prna_
PDB Entry: 3prn (more details), 1.9 Å
PDB Description: e1m, a104w mutant of rh. blastica porin
PDB Compounds: (A:) porinSCOPe Domain Sequences for d3prna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3prna_ f.4.3.1 (A:) Porin {Rhodopseudomonas blastica, strain DSM2131 [TaxId: 1075]}
mislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaklrmqwddgda
fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltydsemgyewssfgdaqssffaynsk
ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa
yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray
vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf
SCOPe Domain Coordinates for d3prna_:
Click to download the PDB-style file with coordinates for d3prna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3prna_:
- d3prna_ first appeared (with stable ids) in SCOP 1.55, called d3prn__
- d3prna_ appears in SCOPe 2.07
View in 3D