Lineage for d3pora_ (3por A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2627486Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2627626Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2627627Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 2627628Protein Porin [56937] (5 species)
  7. 2627689Species Rhodobacter capsulatus [TaxId:1061] [56939] (2 PDB entries)
  8. 2627691Domain d3pora_: 3por A: [43760]
    complexed with c8e, trs

Details for d3pora_

PDB Entry: 3por (more details), 2.5 Å

PDB Description: porin conformation in the absence of calcium; refined structure at 2.5 angstroms resolution
PDB Compounds: (A:) porin

SCOPe Domain Sequences for d3pora_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pora_ f.4.3.1 (A:) Porin {Rhodobacter capsulatus [TaxId: 1061]}
evklsgdarmgvmyngddwnfssrsrvlftmsgttdsglefgasfkahesvgaetgedgt
vflsgafgkiemgdalgasealfgdlyevgytdlddrggndipyltgderltaednpvll
ytysagafsvaasmsdgkvgetseddaqemavaaaytfgnytvglgyekidspdtalmad
meqlelaaiakfgatnvkayyadgeldrdfaravfdltpvaaaatavdhkayglsvdstf
gattvggyvqvldidtiddvtyyglgasydlgggasivggiadndlpnsdmvadlgvkfk
f

SCOPe Domain Coordinates for d3pora_:

Click to download the PDB-style file with coordinates for d3pora_.
(The format of our PDB-style files is described here.)

Timeline for d3pora_: