SCOP 1.75: Domain d2pora_: 2por A:

Lineage for d2pora_ (2por A:)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)

4. Superfamily f.4.3: Porins [56935] (4 families)

5. Family f.4.3.1: Porin [56936] (1 protein)
   trimer, one subunit folds into (16,20) barrel

6. Protein Porin [56937] (5 species)

7. Species Rhodobacter capsulatus [TaxId:1061] [56939] (2 PDB entries)

8. Domain d2pora_: 2por A: [43759]
   complexed with ca, ote

Details for d2pora_

PDB Entry: 2por, 1.8 Å

PDB Description: structure of porin refined at 1.8 angstroms resolution

PDB Compounds: (A:) porin

SCOP Domain Sequences for d2pora_:

Sequence; same for both SEQRES and ATOM records:

>d2pora_ f.4.3.1 (A:) Porin {Rhodobacter capsulatus [TaxId: 1061]}
evklsgdarmgvmyngddwnfssrsrvlftmsgttdsglefgasfkahesvgaetgedgt
vflsgafgkiemgdalgasealfgdlyevgytdlddrggndipyltgderltaednpvll
ytysagafsvaasmsdgkvgetseddaqemavaaaytfgnytvglgyekidspdtalmad
meqlelaaiakfgatnvkayyadgeldrdfaravfdltpvaaaatavdhkayglsvdstf
gattvggyvqvldidtiddvtyyglgasydlgggasivggiadndlpnsdmvadlgvkfk
f

Timeline for d2pora_:

• d2pora_ first appeared (with stable ids) in SCOP 1.55, called d2por__
  
• d2pora_ appears in SCOP 1.73
  
• d2pora_ appears in SCOPe 2.01
  
• d2pora_ appears in the current release, SCOPe 2.08