Lineage for d2por__ (2por -)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 619518Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 619555Superfamily f.4.3: Porins [56935] (4 families) (S)
  5. 619556Family f.4.3.1: Porin [56936] (1 protein)
    trimer, one subunit folds into (16,20) barrel
  6. 619557Protein Porin [56937] (5 species)
  7. 619578Species Rhodobacter capsulatus [TaxId:1061] [56939] (2 PDB entries)
  8. 619579Domain d2por__: 2por - [43759]
    complexed with ca, ote

Details for d2por__

PDB Entry: 2por (more details), 1.8 Å

PDB Description: structure of porin refined at 1.8 angstroms resolution

SCOP Domain Sequences for d2por__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2por__ f.4.3.1 (-) Porin {Rhodobacter capsulatus}
evklsgdarmgvmyngddwnfssrsrvlftmsgttdsglefgasfkahesvgaetgedgt
vflsgafgkiemgdalgasealfgdlyevgytdlddrggndipyltgderltaednpvll
ytysagafsvaasmsdgkvgetseddaqemavaaaytfgnytvglgyekidspdtalmad
meqlelaaiakfgatnvkayyadgeldrdfaravfdltpvaaaatavdhkayglsvdstf
gattvggyvqvldidtiddvtyyglgasydlgggasivggiadndlpnsdmvadlgvkfk
f

SCOP Domain Coordinates for d2por__:

Click to download the PDB-style file with coordinates for d2por__.
(The format of our PDB-style files is described here.)

Timeline for d2por__: