Class f: Membrane and cell surface proteins and peptides [56835] (49 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) |
Superfamily f.4.3: Porins [56935] (4 families) |
Family f.4.3.1: Porin [56936] (1 protein) trimer, one subunit folds into (16,20) barrel |
Protein Porin [56937] (5 species) |
Species Rhodobacter capsulatus [TaxId:1061] [56939] (2 PDB entries) |
Domain d2por__: 2por - [43759] complexed with ca, ote |
PDB Entry: 2por (more details), 1.8 Å
SCOP Domain Sequences for d2por__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2por__ f.4.3.1 (-) Porin {Rhodobacter capsulatus} evklsgdarmgvmyngddwnfssrsrvlftmsgttdsglefgasfkahesvgaetgedgt vflsgafgkiemgdalgasealfgdlyevgytdlddrggndipyltgderltaednpvll ytysagafsvaasmsdgkvgetseddaqemavaaaytfgnytvglgyekidspdtalmad meqlelaaiakfgatnvkayyadgeldrdfaravfdltpvaaaatavdhkayglsvdstf gattvggyvqvldidtiddvtyyglgasydlgggasivggiadndlpnsdmvadlgvkfk f
Timeline for d2por__: