Lineage for d2por__ (2por -)
- Root: SCOP 1.55
Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) 
Fold f.4: Transmembrane beta-barrels [56924] (3 superfamilies) 
Superfamily f.4.3: Porins [56935] (3 families) 
Family f.4.3.1: Porin [56936] (1 protein) Protein Porin [56937] (4 species) Species Rhodobacter capsulatus [TaxId:1061] [56939] (2 PDB entries) 
Domain d2por__: 2por - [43759]
Details for d2por__
PDB Entry: 2por (more details), 1.8 Å
PDB Description: structure of porin refined at 1.8 angstroms resolution
SCOP Domain Sequences for d2por__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2por__ f.4.3.1 (-) Porin {Rhodobacter capsulatus}
evklsgdarmgvmyngddwnfssrsrvlftmsgttdsglefgasfkahesvgaetgedgt
vflsgafgkiemgdalgasealfgdlyevgytdlddrggndipyltgderltaednpvll
ytysagafsvaasmsdgkvgetseddaqemavaaaytfgnytvglgyekidspdtalmad
meqlelaaiakfgatnvkayyadgeldrdfaravfdltpvaaaatavdhkayglsvdstf
gattvggyvqvldidtiddvtyyglgasydlgggasivggiadndlpnsdmvadlgvkfk
f
SCOP Domain Coordinates for d2por__:
Click to download the PDB-style file with coordinates for d2por__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2por__:
- d2por__ appears in SCOP 1.57
- d2por__ appears in the current release, SCOPe 2.08, called d2pora_
View in 3D