![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.4.3: Porins [56935] (5 families) ![]() |
![]() | Family f.4.3.1: Porin [56936] (2 proteins) trimer, one subunit folds into (16,20) barrel |
![]() | Protein Porin [56937] (5 species) |
![]() | Species Rhodobacter capsulatus [TaxId:1061] [56939] (2 PDB entries) |
![]() | Domain d2pora_: 2por A: [43759] complexed with c8e, ca |
PDB Entry: 2por (more details), 1.8 Å
SCOPe Domain Sequences for d2pora_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pora_ f.4.3.1 (A:) Porin {Rhodobacter capsulatus [TaxId: 1061]} evklsgdarmgvmyngddwnfssrsrvlftmsgttdsglefgasfkahesvgaetgedgt vflsgafgkiemgdalgasealfgdlyevgytdlddrggndipyltgderltaednpvll ytysagafsvaasmsdgkvgetseddaqemavaaaytfgnytvglgyekidspdtalmad meqlelaaiakfgatnvkayyadgeldrdfaravfdltpvaaaatavdhkayglsvdstf gattvggyvqvldidtiddvtyyglgasydlgggasivggiadndlpnsdmvadlgvkfk f
Timeline for d2pora_: