SCOPe 2.08: Domain d2pora_: 2por A:

Lineage for d2pora_ (2por A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.4.3: Porins [56935] (5 families)

5. Family f.4.3.1: Porin [56936] (2 proteins)
   trimer, one subunit folds into (16,20) barrel

6. Protein Porin [56937] (5 species)

7. Species Rhodobacter capsulatus [TaxId:1061] [56939] (2 PDB entries)

8. Domain d2pora_: 2por A: [43759]
   complexed with c8e, ca

Details for d2pora_

PDB Entry: 2por, 1.8 Å

PDB Description: structure of porin refined at 1.8 angstroms resolution

PDB Compounds: (A:) porin

SCOPe Domain Sequences for d2pora_:

Sequence; same for both SEQRES and ATOM records:

>d2pora_ f.4.3.1 (A:) Porin {Rhodobacter capsulatus [TaxId: 1061]}
evklsgdarmgvmyngddwnfssrsrvlftmsgttdsglefgasfkahesvgaetgedgt
vflsgafgkiemgdalgasealfgdlyevgytdlddrggndipyltgderltaednpvll
ytysagafsvaasmsdgkvgetseddaqemavaaaytfgnytvglgyekidspdtalmad
meqlelaaiakfgatnvkayyadgeldrdfaravfdltpvaaaatavdhkayglsvdstf
gattvggyvqvldidtiddvtyyglgasydlgggasivggiadndlpnsdmvadlgvkfk
f

Timeline for d2pora_:

• d2pora_ first appeared (with stable ids) in SCOP 1.55, called d2por__
  
• d2pora_ appears in SCOPe 2.07