Lineage for d1opfa_ (1opf A:)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 744694Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 744736Superfamily f.4.3: Porins [56935] (4 families) (S)
  5. 744737Family f.4.3.1: Porin [56936] (1 protein)
    trimer, one subunit folds into (16,20) barrel
  6. 744738Protein Porin [56937] (5 species)
  7. 744743Species Escherichia coli, different sequences [TaxId:562] [56938] (13 PDB entries)
  8. 744755Domain d1opfa_: 1opf A: [43757]

Details for d1opfa_

PDB Entry: 1opf (more details), 3.2 Å

PDB Description: the structure of ompf porin in a tetragonal crystal form
PDB Compounds: (A:) matrix porin outer membrane protein f

SCOP Domain Sequences for d1opfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1opfa_ f.4.3.1 (A:) Porin {Escherichia coli, different sequences [TaxId: 562]}
aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf

SCOP Domain Coordinates for d1opfa_:

Click to download the PDB-style file with coordinates for d1opfa_.
(The format of our PDB-style files is described here.)

Timeline for d1opfa_: