Lineage for d1bt9a_ (1bt9 A:)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 39230Fold f.4: Transmembrane beta-barrels [56924] (3 superfamilies)
  4. 39248Superfamily f.4.3: Porins [56935] (3 families) (S)
  5. 39249Family f.4.3.1: Porin [56936] (1 protein)
  6. 39250Protein Porin [56937] (4 species)
  7. 39251Species Escherichia coli, different sequences [TaxId:562] [56938] (10 PDB entries)
  8. 39258Domain d1bt9a_: 1bt9 A: [43756]

Details for d1bt9a_

PDB Entry: 1bt9 (more details), 3 Å

PDB Description: ompf porin mutant d74a

SCOP Domain Sequences for d1bt9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bt9a_ f.4.3.1 (A:) Porin {Escherichia coli, different sequences}
aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
weynfqgnnsegaaaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf

SCOP Domain Coordinates for d1bt9a_:

Click to download the PDB-style file with coordinates for d1bt9a_.
(The format of our PDB-style files is described here.)

Timeline for d1bt9a_: